MPP1 antibody (C-Term)
-
- Target See all MPP1 Antibodies
- MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))
-
Binding Specificity
- AA 409-450, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MPP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- TEALQQLQKD SEAIRSQYAH YFDLSLVNNG VDETLKKLQE AF
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: membrane palmitoylated protein 1
Protein Name: 55 kDa erythrocyte membrane protein - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product MPP1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))
- Alternative Name
- MPP1 (MPP1 Products)
- Synonyms
- AAG12 antibody, DXS552E antibody, EMP55 antibody, MRG1 antibody, PEMP antibody, MGC53500 antibody, MGC89895 antibody, MPP1 antibody, p55 antibody, cb997 antibody, zgc:77039 antibody, wu:fc85f03 antibody, 55kDa antibody, C130070C03Rik antibody, membrane palmitoylated protein 1 antibody, membrane protein, palmitoylated 1 L homeolog antibody, membrane protein, palmitoylated 1 antibody, membrane protein, palmitoylated antibody, MPP1 antibody, mpp1.L antibody, mpp1 antibody, Mpp1 antibody
- Background
-
55 kDa erythrocyte membrane protein is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: AAG 12 | AAG12 | DXS552 | DXS552E | EMP 55 | EMP55 | MPP 1 | MPP1 | MRG 1 | MRG1 | p55 | palmitoylated 1 | PEMP | Q00013 - Gene ID
- 4354
- UniProt
- Q00013
-