PLIN3 antibody (C-Term)

Catalog No. ABIN4886698

Product Details anti-PLIN3 Antibody

Target: PLIN3 (Perilipin 3 (PLIN3))

Binding Specificity: AA 323-365, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLIN3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: ESRALTMFRD IAQQLQATCT SLGSSIQGLP TNVKDQVQQA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Perilipin-3(PLIN3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: perilipin 3
Protein Name: Perilipin-3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQA RRQ), different from the related mouse sequence by fourteen amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PLIN3

Target: PLIN3 (Perilipin 3 (PLIN3))

Alternative Name: PLIN3 (PLIN3 Products)

Synonyms: 1300012C15Rik antibody, M6prbp1 antibody, Tip47 antibody, M6PRBP1 antibody, PP17 antibody, TIP47 antibody, fl05f04 antibody, wu:fl05f04 antibody, m6prbp1 antibody, MGC80328 antibody, PLIN3 antibody, pp17 antibody, tip47 antibody, MGC53750 antibody, perilipin 3 antibody, si:rp71-61h23.4 antibody, perilipin 3 S homeolog antibody, perilipin 3 L homeolog antibody, Plin3 antibody, PLIN3 antibody, si:rp71-61h23.4 antibody, plin3.S antibody, plin3.L antibody

Background: Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: M6PRBP 1 | M6PRBP1 | Perilipin 3 | Perilipin3 | Perilipin-3 | PLIN3 | pp17 | Placental protein 17 | TIP47 | O60664

Gene ID: 10226

UniProt: O60664