Did you know that you can buy products from over 140 different suppliers from us?

Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (Middle Region) antibody

Details for Product No. ABIN501312
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310065A22Rik, AI426270, AW214556, D130071B19Rik, Nirf, NIRF, RNF107, URF2
Epitope
Middle Region
(7), (7), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(35), (15), (13), (12), (12)
Host
Rabbit
(31), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (12), (9), (7), (6), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501312
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human UHRF2
Sequence NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPE EGNRYDGIYK
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against UHRF2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UHRF2
Background UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Molecular Weight 90 kDa
Gene ID 115426
NCBI Accession NM_152896, NP_690856
UniProt Q96PU4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 802 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Unoki, Nishidate, Nakamura: "ICBP90, an E2F-1 target, recruits HDAC1 and binds to methyl-CpG through its SRA domain." in: Oncogene, Vol. 23, Issue 46, pp. 7601-10, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501312
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top