Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501312

Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310065A22Rik, AI426270, AW214556, D130071B19Rik, Nirf, NIRF, RNF107, URF2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501312
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the middle region of human UHRF2
Sequence NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPE EGNRYDGIYK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 91%
Characteristics This is a rabbit polyclonal antibody against UHRF2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UHRF2
Background UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.
Molecular Weight 90kDa
Gene ID 115426
NCBI Accession NP_690856, NM_152896
UniProt Q96PU4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UHRF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Unoki, Nishidate, Nakamura: "ICBP90, an E2F-1 target, recruits HDAC1 and binds to methyl-CpG through its SRA domain." in: Oncogene, Vol. 23, Issue 46, pp. 7601-10, 2004 (PubMed).

Alternatives for antigen "Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2)", type "Antibodies"
Hosts (23), (7)
Reactivities (28), (15), (13), (13), (12), (1), (1)
Applications (20), (9), (7), (6), (6), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1), (1), (1)
Beacon