TRIO and F-Actin Binding Protein (TRIOBP) antibody

Antigen: TRIO and F-Actin Binding Protein (TRIOBP)

Synonyms: TARA, DFNB28, FLJ39315, KIAA1662, dJ37E16.4, HRIHFB2122

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN501329

Additional Information

Alternative name: TRIOBP / TARA

Gene ID: TRIOBP

UniProt: A6NID1

Immunogen: The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP

Sequence: QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTK LSDSNKENAL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIOBP antibody concentration is 1 mg/ml.

Description: TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. The protein also associates with F-actin and stabilizes F-actin structures. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness.This gene encodes a protein that interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cell growth. This trio-binding protein also associates with F-actin and stabilizes F-actin structures. Domains contained in this encoded protein are an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. Mutations in this gene have been associated with a form of autosomal recessive nonsyndromic deafness. Multiple alternatively spliced transcript variants that would encode different isoforms have been found for this gene, however some transcripts may be subject to nonsense-mediated decay (NMD).

Characteristics: Antigen Size: 431 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Publications

Product: Yu, Lan, Zhu et al.: "The E3 ubiquitin ligase HECTD3 regulates ubiquitination and degradation of Tara." in: Biochemical and biophysical research communications, Vol. 367, Issue 4, pp. 805-12, 2008 (PubMed).