Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 773 (ZNF773) (N-Term) antibody

Details for Product No. ABIN501351
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF773, ZNF419B, RGD1563793, Znf773
Epitope
N-Term
(12), (7), (3), (2), (1), (1), (1)
Reactivity
Human
(18), (1), (1), (1), (1), (1)
Host
Rabbit
(19), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (6), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501351
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF773
Sequence AAATLRDPAQQGYVTFEDVAVYFSQEEWRLLDDAQRLLYR NVMLENFTLL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF773. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF773
Background ZNF773 may be involved in transcriptional regulation.
Molecular Weight 50 kDa
Gene ID 374928
NCBI Accession NM_198542, NP_940944
UniProt Q6PK81
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 442 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501351
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top