Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4) (Middle Region) antibody

Details for Product No. ABIN501375
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HIR, HIRK2, HRK1, IRK-3, IRK3, Kir2.3, Kcnf2, MB-IRK3, Hirk2, KCNJ4, CKIR2.3
Epitope
Middle Region
(6), (5), (4), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(21), (12), (11), (2)
Host
Rabbit
(15), (9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (7), (5), (5), (5), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501375
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KCNJ4
Sequence AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLD NISYRRESAI
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against KCNJ4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNJ4
Background KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have??een found for this gene. Several different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neuronsSeveral different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. The protein encoded by this gene is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 49 kDa
Gene ID 3761
NCBI Accession NM_004981, NP_004972
UniProt P48050
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 445 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4) (Middle Region) antibody WB Suggested Anti-KCNJ4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Background publications Ji, Foo, ORoak et al.: "Rare independent mutations in renal salt handling genes contribute to blood pressure variation." in: Nature genetics, Vol. 40, Issue 5, pp. 592-9, 2008 (PubMed).

Hosts (15), (9)
Reactivities (21), (12), (11), (2)
Applications (24), (7), (5), (5), (5), (4), (2), (2), (1)
Epitopes (6), (5), (4), (3), (1), (1), (1)
back to top