Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501403

Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERG-2, ERG2, HERG2, Kv11.2, hERG-2, Erg2, m-erg2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501403
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6
Sequence PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQ GLICGPCFSS
Predicted Reactivity Human : 100%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against KCNH6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCNH6
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined.
Molecular Weight 100kDa
Gene ID 81033
NCBI Accession NP_775115, NM_173092
UniProt Q9H252-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNH6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Alternatives for antigen "Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6)", type "Antibodies"
Hosts (13), (1)
Reactivities (9), (3), (3), (3), (3), (1), (1)
Applications (13), (4), (2), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon