Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 44 (ZBTB44) (Middle Region) antibody

Details for Product No. ABIN501469
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms btbd15, hspc063, MGC145247, BTBD15, HSPC063, ZNF851, 6030404E16Rik, Btbd15, E230011F09, RGD1308984
Epitope
Middle Region
(10), (7), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(29), (15), (13), (13), (13), (12), (12)
Host
Rabbit
(29), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (10), (6), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501469
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB44
Sequence SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRN QPVDSSLAFP
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Chicken : 90 %, Rabbit : 90 %, Rat : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against ZBTB44. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB44
Background ZBTB44 contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 50 kDa
Gene ID 29068
NCBI Accession NM_014155, NP_054874
UniProt Q8NCP5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 453 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 44 (ZBTB44) (Middle Region) antibody WB Suggested Anti-ZBTB44 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Validation Images
back to top