Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501469

Zinc Finger and BTB Domain Containing 44 (ZBTB44) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD15, HSPC063, ZNF851, 6030404E16Rik, Btbd15, E230011F09, RGD1308984, btbd15, hspc063, MGC145247
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501469
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB44 antibody: synthetic peptide directed towards the middle region of human ZBTB44
Sequence SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRN QPVDSSLAFP
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Chicken : 92%, Rabbit : 92%, Rat : 92%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against ZBTB44. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB44
Background ZBTB44 contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Molecular Weight 50kDa
Gene ID 29068
NCBI Accession NP_054874, NM_014155
UniProt Q8NCP5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB44 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 44 (ZBTB44)", type "Antibodies"
Hosts (21), (1)
Reactivities (21), (15), (13), (13), (13), (12), (12)
Applications (13), (10), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (1), (1), (1)
Beacon