Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 649 (ZNF649) (N-Term) antibody

Details for Product No. ABIN501494
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(7), (7), (1)
Reactivity
Human
(10)
Host
Rabbit
(10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501494
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF649
Sequence HGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQM PTEIEFPESR
Predicted Reactivity Horse : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF649. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF649
Background ZNF649 is the transcriptional repressor. ZNF649 is the regulator of transcriptional factor complexes and may suppress SRE and AP-1 transcription activities mediated by growth factor signaling pathways.
Molecular Weight 58 kDa
Gene ID 65251
NCBI Accession NM_023074, NP_075562
UniProt Q9BS31
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 505 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 649 (ZNF649) (N-Term) antibody WB Suggested Anti-ZNF649 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top