Zinc Finger Protein 649 (ZNF649) (N-Term) antibody

Details for Product No. ABIN501494
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(1), (1), (1)
Reactivity
Human
(4)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (1)
Pubmed 1 reference available
Catalog no. ABIN501494
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF649
Sequence HGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQM PTEIEFPESR
Predicted Reactivity Horse : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF649. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF649
Background ZNF649 is the transcriptional repressor. ZNF649 is the regulator of transcriptional factor complexes and may suppress SRE and AP-1 transcription activities mediated by growth factor signaling pathways.
Molecular Weight 58 kDa
Gene ID 65251
NCBI Accession NM_023074, NP_075562
UniProt Q9BS31
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 505 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 649 (ZNF649) (N-Term) antibody WB Suggested Anti-ZNF649 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (4)
Reactivities (4)
Applications (4), (1)
Epitopes (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top