Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501494

Zinc Finger Protein 649 (ZNF649) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501494
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF649 antibody: synthetic peptide directed towards the N terminal of human ZNF649
Sequence HGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQM PTEIEFPESR
Predicted Reactivity Horse : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF649. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF649
Background ZNF649 is the transcriptional repressor. ZNF649 is the regulator of transcriptional factor complexes and may suppress SRE and AP-1 transcription activities mediated by growth factor signaling pathways.
Molecular Weight 58kDa
Gene ID 65251
NCBI Accession NP_075562, NM_023074
UniProt Q9BS31
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF649 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 649 (ZNF649)", type "Antibodies"
Hosts (3)
Reactivities (3)
Applications (3)
Epitopes (3), (2), (1)
Beacon