Zinc Finger Protein 669 (ZNF669) antibody

Antigen: Zinc Finger Protein 669 (ZNF669)

Synonyms: FLJ12606

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN501497

Additional Information

Alternative name: ZNF669

Gene ID: ZNF669

UniProt: Q96BR6

Immunogen: The immunogen for anti-ZNF669 antibody: synthetic peptide directed towards the N terminal of human ZNF669

Sequence: LDSSQKNLYREVMQETCRNLASVGSQWKDQNIEDHFEKPG KDIRNHIVQR

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF669 antibody concentration is 1 mg/ml.

Description: ZNF669 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 464 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-ZNF669 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF669 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).