Zinc Finger Protein 670 (ZNF670) (N-Term) antibody

Details for Product No. ABIN501506
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF670
Epitope
N-Term
(2), (1)
Reactivity
Human
(7)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501506
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF670
Sequence EIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEI KEGSQYGETF
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF670. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF670
Background ZNF670 may be involved in transcriptional regulation.
Molecular Weight 44 kDa
Gene ID 93474
NCBI Accession NM_033213, NP_149990
UniProt Q9BS34
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 389 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (6), (1)
Reactivities (7)
Applications (5), (1), (1), (1), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top