Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501704

Thyroid Hormone Receptor Associated Protein 3 (THRAP3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TRAP150, 9330151F09Rik, B230333E16Rik, Trap150, Snm1-like, trap150, Thrap3, MGC132228
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501704
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3
Sequence GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDES GTENREEKDN
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Rabbit : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against THRAP3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name THRAP3
Background THRAP3 plays a role in transcriptional coactivation.
Molecular Weight 109kDa
Gene ID 9967
NCBI Accession NP_005110, NM_005119
UniProt Q9Y2W1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-THRAP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Thyroid Hormone Receptor Associated Protein 3 (THRAP3)", type "Antibodies"
Hosts (26)
Reactivities (26), (15), (15), (15), (15), (12), (4), (3), (3), (3), (1)
Applications (16), (10), (9), (4), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (2), (1), (1)
Beacon