Did you know that you can buy products from over 140 different suppliers from us?

Thyroid Hormone Receptor Associated Protein 3 (THRAP3) (Middle Region) antibody

Details for Product No. ABIN501704
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TRAP150, 9330151F09Rik, B230333E16Rik, Trap150, Snm1-like, trap150, Thrap3, MGC132228
Epitope
Middle Region
(12), (8), (3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
(33), (16), (15), (14), (14), (12), (3), (3), (2), (2), (1)
Host
Rabbit
(33), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (10), (9), (9), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501704
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human THRAP3
Sequence GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDES GTENREEKDN
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Rabbit : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against THRAP3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name THRAP3
Background THRAP3 plays a role in transcriptional coactivation.
Molecular Weight 109 kDa
Gene ID 9967
NCBI Accession NM_005119, NP_005110
UniProt Q9Y2W1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 955 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501704
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top