Kelch-Like 5 (Drosophila) (KLHL5) (Middle Region) antibody

Details for Product No. ABIN501784
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300013C10Rik
Epitope
Middle Region
(4), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human, Chicken
(10), (2), (2), (1)
Host
Rabbit
(9), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501784
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KLHL5
Sequence LLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLG RAGACVVTVK
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Zebrafish : 100 %, Chicken : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against KLHL5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KLHL5
Background The kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family were cytoskeletal proteins implicated in various cellul
Molecular Weight 84 kDa
Gene ID 51088
NCBI Accession NM_015990, NP_057074
UniProt Q96PQ7
Research Area Signaling, Cytoskeleton, Microfilaments
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 755 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 5 (Drosophila) (KLHL5) (Middle Region) antibody WB Suggested Anti-KLHL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1 cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Validation Images
back to top