Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501788

Suppressor of Fused Homolog (Drosophila) (SUFUH) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810026F04Rik, Su(fu), b2b273Clo, CG6054, Dmel\\CG6054, SU(FU), SUFU, Su(Fu), SuFu, Sufu, su(fu), sufu, dre, fi39e05, wu:fi39e05, Xsufu, sufuh, sufuxl, SUFUH, SUFUXL, PRO1280
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN501788
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU
Sequence LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLK VSILPDVVFD
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against SUFU. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SUFU
Background SUFU is a component of the Sonic hedgehog (SHH, MIM 600725)/Patched (PTCH, MIM 601309) signaling pathway. Mutations in genes encoding components of this pathway are deleterious for normal development and are associated with cancer-predisposing syndromes.SUFU encodes a component of the sonic hedgehog (SHH, MIM 600725)/patched (PTCH, MIM 601309) signaling pathway. Mutations in genes encoding components of this pathway are deleterious for normal development and are associated with cancer-predisposing syndromes (e.g., HPE3, MIM 142945, BCNS, MIM 109400, and GCPS, MIM 175700).
Molecular Weight 54kDa
Gene ID 51684
NCBI Accession NP_057253, NM_016169
UniProt Q9UMX1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SUFU antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Deng, Wang et al.: "MicroRNA-378 promotes cell survival, tumor growth, and angiogenesis by targeting SuFu and Fus-1 expression." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 51, pp. 20350-5, 2007 (PubMed).

Alternatives for antigen "Suppressor of Fused Homolog (Drosophila) (SUFUH)", type "Antibodies"
Hosts (37), (3), (2)
Reactivities (39), (19), (18), (15), (14), (13), (4), (4), (2), (2), (1)
Applications (21), (10), (10), (8), (6), (5), (4), (2), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon