Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501795

Chromatin Accessibility Complex 1 (CHRAC1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHARC1, CHARC15, CHRAC-1, CHRAC-15, CHRAC15, YCL1, 2410152E03Rik, 2810406L04Rik, chrac1, CHRAC1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501795
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHRAC1 antibody: synthetic peptide directed towards the middle region of human CHRAC1
Sequence SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNE SDHDEADS
Predicted Reactivity Human : 100%, Horse : 75%
Characteristics This is a rabbit polyclonal antibody against CHRAC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHRAC1
Background CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Molecular Weight 15kDa
Gene ID 54108
NCBI Accession NP_059140, NM_017444
UniProt Q9NRG0
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHRAC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Collins, Poot, Kukimoto et al.: "An ACF1-ISWI chromatin-remodeling complex is required for DNA replication through heterochromatin." in: Nature genetics, Vol. 32, Issue 4, pp. 627-32, 2002 (PubMed).

Alternatives for antigen "Chromatin Accessibility Complex 1 (CHRAC1)", type "Antibodies"
Hosts (12), (11)
Reactivities (23), (8), (3), (1)
Applications (17), (16), (6), (3), (2), (1)
Epitopes (3), (2), (2), (2), (1)
Beacon