Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501827

Tripartite Motif Containing 34 (TRIM34) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IFP1, RNF21, TRIM34
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501827
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM34 antibody: synthetic peptide directed towards the N terminal of human TRIM34
Sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHL ANIVERLKEV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TRIM34. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM34
Background TRIM34 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped
Molecular Weight 31kDa
Gene ID 53840
NCBI Accession NP_569074, NM_130390
UniProt Q9BYJ4-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM34 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 34 (TRIM34)", type "Antibodies"
Hosts (8), (1)
Reactivities (9), (1), (1), (1), (1)
Applications (9), (3), (2), (2)
Epitopes (6), (2), (1), (1)
Beacon