Did you know that you can buy products from over 140 different suppliers from us?

Tripartite Motif Containing 34 (TRIM34) (N-Term) antibody

Details for Product No. ABIN501827
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TRIM34, IFP1, RNF21, Trim34, Trim34-1
Epitope
N-Term
(11), (7), (2), (1)
Reactivity
Human
(15), (1), (1), (1), (1)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (8), (7), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501827
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIM34
Sequence CRACITVSNKEAVTSMGGKSSCPVCGISYSFEHLQANQHL ANIVERLKEV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TRIM34. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM34
Background TRIM34 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Expression of this gene is up-regulated by interferon. This gene is mappped
Molecular Weight 31 kDa
Gene ID 53840
NCBI Accession NM_130390, NP_569074
UniProt Q9BYJ4-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 270 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 34 (TRIM34) (N-Term) antibody Host: Rabbit
Target Name: TRIM34
Sample Tissue: Human Adult Placenta
Antibody Dilution: 1.0 µg/mL
anti-Tripartite Motif Containing 34 (TRIM34) (N-Term) antibody (2) Host: Rabbit
Target Name: TRIM34
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0 µg/mL
anti-Tripartite Motif Containing 34 (TRIM34) (N-Term) antibody (3) Host: Rabbit
Target Name: TRIM34
Sample Tissue: Human Fetal Muscle
Antibody Dilution: 1.0 µg/mL
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Validation Images
back to top