Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501844

Zinc Finger Protein 329 (ZNF329) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF329, 2810439M05Rik, 4632409L22Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501844
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF329 antibody: synthetic peptide directed towards the middle region of human ZNF329
Sequence SFKQNSHLAVHQRLHSREGPSRCPQCGKMFQKSSSLVRHQ RAHLGEQPME
Predicted Reactivity Horse : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF329. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF329
Background The function of ZNF329 remains unknown.
Molecular Weight 62kDa
Gene ID 79673
NCBI Accession NP_078896, NM_024620
UniProt Q86UD4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF329 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 329 (ZNF329)", type "Antibodies"
Hosts (18)
Reactivities (18)
Applications (18), (7), (1), (1)
Epitopes (7), (4), (1)
Beacon