Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501868

Zinc Finger Protein 682 (ZNF682) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC39498_3, ZNF682
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501868
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF682 antibody: synthetic peptide directed towards the middle region of human ZNF682
Sequence KGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSE LRQHSCSSSG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF682. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF682
Background ZNF682 contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF682 may be involved in transcriptional regulation.
Molecular Weight 58kDa
Gene ID 91120
NCBI Accession NP_149973, NM_033196
UniProt O95780
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF682 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 682 (ZNF682)", type "Antibodies"
Hosts (16)
Reactivities (16), (1), (1), (1)
Applications (16), (5)
Epitopes (4), (2), (2), (1), (1)
Beacon