Zinc Finger Protein 682 (ZNF682) (Middle Region) antibody

Details for Product No. ABIN501868
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC39498_3, ZNF682
Epitope
Middle Region
(5), (1), (1), (1)
Reactivity
Human
(18), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (7)
Pubmed 1 reference available
Catalog no. ABIN501868
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF682
Sequence KGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSE LRQHSCSSSG
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF682. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF682
Background ZNF682 contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF682 may be involved in transcriptional regulation.
Molecular Weight 58 kDa
Gene ID 91120
NCBI Accession NM_033196, NP_149973
UniProt O95780
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 498 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Hosts (18)
Reactivities (18), (1), (1), (1)
Applications (18), (7)
Epitopes (5), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top