TRIO and F-Actin Binding Protein (TRIOBP) antibody

Antigen: TRIO and F-Actin Binding Protein (TRIOBP)

Synonyms: TARA, DFNB28, FLJ39315, KIAA1662, dJ37E16.4, HRIHFB2122

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN501880

Additional Information

Alternative name: TRIOBP / TARA

Gene ID: TRIOBP

Immunogen: The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP

Sequence: VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVG VITVPVLQTR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TRIOBP antibody concentration is 1 mg/ml.

Description: TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cel

Characteristics: Antigen Size: 431 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TRIOBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate

Publications

Product: Yu, Lan, Zhu et al.: "The E3 ubiquitin ligase HECTD3 regulates ubiquitination and degradation of Tara." in: Biochemical and biophysical research communications, Vol. 367, Issue 4, pp. 805-12, 2008 (PubMed).