Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502027

Pre-MRNA Branch Site Protein p14 (SF3B14) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 6030419K15Rik, AV001342, Sf3b14, HSPC175, Ht006, P14, SAP14, SF3B14a, zgc:86708
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502027
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the N terminal of human SF3B14
Sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFG KYGPIRQIRV
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against SF3B14. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SF3B14
Background SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site. This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
Molecular Weight 14kDa
Gene ID 51639
NCBI Accession NP_057131, NM_016047
UniProt Q9Y3B4
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SF3B14 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Pre-MRNA Branch Site Protein p14 (SF3B14)", type "Antibodies"
Hosts (16)
Reactivities (14), (6), (1), (1), (1), (1), (1)
Applications (16), (7), (3), (2)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon