Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502047

Poly(rC) Binding Protein 3 (PCBP3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCBP3, fb36h02, wu:fb36h02, zgc:55964, PCBP2, AlphaCP-3, ALPHA-CP3, alpha-CP3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502047
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCBP3 antibody: synthetic peptide directed towards the middle region of human PCBP3
Sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDAS PPASTHELTI
Predicted Reactivity Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against PCBP3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PCBP3
Background This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
Molecular Weight 36kDa
Gene ID 54039
NCBI Accession NP_065389, NM_020528
UniProt P57721
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCBP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Poly(rC) Binding Protein 3 (PCBP3)", type "Antibodies"
Hosts (2), (2), (1)
Reactivities (4)
Applications (3), (2), (1)
Epitopes (2), (1), (1), (1)
Beacon