Did you know that you can buy products from over 140 different suppliers from us?

Poly(rC) Binding Protein 3 (PCBP3) (Middle Region) antibody

Details for Product No. ABIN502047
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCBP3, fb36h02, wu:fb36h02, zgc:55964, PCBP2, ALPHA-CP3, alpha-CP3, AlphaCP-3
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Human, Chicken
(5), (1), (1), (1)
Host
Rabbit
(3), (2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502047
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PCBP3
Sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDAS PPASTHELTI
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against PCBP3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PCBP3
Background This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
Molecular Weight 36 kDa
Gene ID 54039
NCBI Accession NM_020528, NP_065389
UniProt P57721
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 339 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly(rC) Binding Protein 3 (PCBP3) (Middle Region) antibody WB Suggested Anti-PCBP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Validation Images
back to top