Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502143

Formiminotransferase Cyclodeaminase (FTCD) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fp37b11, zgc:63647, LCHC1, FTCD
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN502143
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FTCD antibody: synthetic peptide directed towards the middle region of human FTCD
Sequence KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKV QGIGWYLDEK
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 92%, Horse : 92%, African clawed frog : 85%, Chicken : 85%, Rabbit : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against FTCD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FTCD
Background FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.
Molecular Weight 59kDa
Gene ID 10841
NCBI Accession NP_006648, NM_006657
UniProt O95954
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FTCD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Hillman, Green, Brenner: "An unappreciated role for RNA surveillance." in: Genome biology, Vol. 5, Issue 2, pp. R8, 2004 (PubMed).

Alternatives for antigen "Formiminotransferase Cyclodeaminase (FTCD)", type "Antibodies"
Hosts (11), (7), (5)
Reactivities (20), (3), (3), (3), (1), (1), (1)
Applications (23), (9), (6), (6), (3), (1), (1)
Epitopes (6), (3)
Beacon