Did you know that you can buy products from over 140 different suppliers from us?

Formiminotransferase Cyclodeaminase (FTCD) (Middle Region) antibody

Details for Product No. ABIN502143
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fp37b11, zgc:63647, LCHC1, FTCD
Epitope
Middle Region
(3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(14), (3), (3), (2), (1), (1), (1)
Host
Rabbit
(9), (4), (3)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (5), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502143
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FTCD
Sequence KFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKV QGIGWYLDEK
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Guinea pig : 90 %, Horse : 90 %, African clawed frog : 80 %, Chicken : 80 %, Rabbit : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against FTCD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FTCD
Background FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.
Molecular Weight 59 kDa
Gene ID 10841
NCBI Accession NM_006657, NP_006648
UniProt O95954
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 549 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Formiminotransferase Cyclodeaminase (FTCD) (Middle Region) antibody anti-Formiminotransferase Cyclodeaminase (FTCD) (Middle Region) antibody
anti-Formiminotransferase Cyclodeaminase (FTCD) (Middle Region) antibody (2) anti-Formiminotransferase Cyclodeaminase (FTCD) (Middle Region) antibody (Image 2)
Product cited in: Hillman, Green, Brenner: "An unappreciated role for RNA surveillance." in: Genome biology, Vol. 5, Issue 2, pp. R8, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502143
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top