Did you know that you can buy products from over 140 different suppliers from us?

Transmembrane Protein 2 (TMEM2) (Middle Region) antibody

Details for Product No. ABIN502252
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3110012M15Rik, mKIAA1412
Epitope
Middle Region
(2), (1)
Reactivity
Human
(7), (6)
Host
Rabbit
(10), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (2), (2), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502252
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TMEM2
Sequence MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRG DPSVISVNGT
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against TMEM2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM2
Background The function of this protein remains unknown.
Molecular Weight 154 kDa
Gene ID 23670
NCBI Accession NM_013390, NP_037522
UniProt Q9UHN6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1383 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 2 (TMEM2) (Middle Region) antibody WB Suggested Anti-TMEM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate
Background publications Scott, Drury, Sundstrom et al.: "Refining the DFNB7-DFNB11 deafness locus using intragenic polymorphisms in a novel gene, TMEM2." in: Gene, Vol. 246, Issue 1-2, pp. 265-74, 2000 (PubMed).

Hosts (10), (1)
Reactivities (7), (6)
Applications (11), (2), (2), (2), (2)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502252
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top