Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502252

Transmembrane Protein 2 (TMEM2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3110012M15Rik, mKIAA1412
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502252
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM2 antibody: synthetic peptide directed towards the middle region of human TMEM2
Sequence MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRG DPSVISVNGT
Predicted Reactivity Human : 100%, Rabbit : 100%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Rat : 92%, Bovine : 85%
Characteristics This is a rabbit polyclonal antibody against TMEM2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM2
Background The function of this protein remains unknown.
Molecular Weight 154kDa
Gene ID 23670
NCBI Accession NP_037522, NM_013390
UniProt Q9UHN6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scott, Drury, Sundstrom et al.: "Refining the DFNB7-DFNB11 deafness locus using intragenic polymorphisms in a novel gene, TMEM2." in: Gene, Vol. 246, Issue 1-2, pp. 265-74, 2000 (PubMed).

Alternatives for antigen "Transmembrane Protein 2 (TMEM2)", type "Antibodies"
Hosts (8)
Reactivities (5), (4)
Applications (8), (1)
Epitopes (2), (1)
Beacon