Did you know that you can buy products from over 140 different suppliers from us?

Multiple PDZ Domain Protein (MPDZ) (Middle Region) antibody

Details for Product No. ABIN502311
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HYC2, MUPP1, AI225843, B930003D11Rik
Epitope
Middle Region
(1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(18), (12), (12), (12), (12), (1)
Host
Rabbit
(19), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(10), (8), (4), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502311
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MPDZ
Sequence DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQK KPGKGLGLSI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against MPDZ. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MPDZ
Background The exact function of MPDZ remains unknown.
Molecular Weight 218 kDa
Gene ID 8777
NCBI Accession NM_003829, NP_003820
UniProt O75970
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 2041 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Multiple PDZ Domain Protein (MPDZ) (Middle Region) antibody WB Suggested Anti-MPDZ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
anti-Multiple PDZ Domain Protein (MPDZ) (Middle Region) antibody (2) anti-Multiple PDZ Domain Protein (MPDZ) (Middle Region) antibody (Image 2)
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502311
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top