Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502354

Myosin Regulatory Light Chain Interacting Protein (MYLIP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MIR, IDOL, 9430057C20Rik, Mir, mylip, zgc:55987, wu:fj36b03, MYLIP, mir
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502354
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MYLIP antibody: synthetic peptide directed towards the middle region of human MYLIP
Sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTF CPCGHTVCCE
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Rabbit : 92%, Chicken : 85%, Pig : 85%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against MYLIP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MYLIP
Background The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowthThe ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.
Molecular Weight 50kDa
Gene ID 29116
NCBI Accession NP_037394, NM_013262
UniProt Q8WY64
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Proteolysis / Ubiquitin, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MYLIP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ohmura-Hoshino, Matsuki, Aoki et al.: "Inhibition of MHC class II expression and immune responses by c-MIR." in: Journal of immunology (Baltimore, Md. : 1950), Vol. 177, Issue 1, pp. 341-54, 2006 (PubMed).

Alternatives for antigen "Myosin Regulatory Light Chain Interacting Protein (MYLIP)", type "Antibodies"
Hosts (25), (1), (1)
Reactivities (26), (22), (19), (12), (12), (12)
Applications (17), (12), (10), (9), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
Beacon