Der1-Like Domain Family, Member 3 (DERL3) (C-Term) antibody

Details for Product No. ABIN502515
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1810006I20Rik, 1810063P04Rik, IZP6, derlin-3, C22orf14, LLN2, zgc:63991
Epitope
C-Term
(12), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
(17)
Host
Rabbit
(19)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (12), (8), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN502515
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human DERL3
Sequence YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPL PEEQPGPHLP
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against DERL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DERL3
Background DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL3 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).
Molecular Weight 27 kDa
Gene ID 91319
NCBI Accession NM_001002862, NP_001002862
UniProt Q96Q80
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 235 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Morrison, Lööf, He et al.: "Salamander limb regeneration involves the activation of a multipotent skeletal muscle satellite cell population." in: The Journal of cell biology, Vol. 172, Issue 3, pp. 433-40, 2006 (PubMed).

Hosts (19)
Reactivities (17)
Applications (18), (12), (8), (4), (1)
Epitopes (12), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top