Der1-Like Domain Family, Member 3 (DERL3) (C-Term) antibody

Details for Product No. ABIN634939
Antigen
Epitope
C-Term
11
2
2
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
19
5
4
4
4
4
4
4
3
2
2
2
1
1
1
Host
Rabbit
19
Clonality
Polyclonal
Application
Western Blotting (WB)
18
10
8
4
2
1
Options
Immunogen DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP
Specificity DERL3 antibody was raised against the C terminal of DERL3
Purification Affinity purified
Antigen
Alternative Name DERL3 (DERL3 Antibody Abstract)
Background DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Molecular Weight 27 kDa (MW of target protein)
Pathways ER-Nucleus Signaling
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Der1-Like Domain Family, Member 3 (DERL3) (C-Term) antibody (ABIN634939) DERL3 antibody used at 1 ug/ml to detect target protein.