Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Der1-Like Domain Family, Member 3 (DERL3) (C-Term) antibody Primary Antibody

DERL3 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634939
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    Der1-Like Domain Family, Member 3 (DERL3)
    Binding Specificity
    C-Term
    • 4
    • 2
    • 2
    • 1
    Reactivity
    Human, Mouse, Rat
    • 11
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Host
    Rabbit
    Clonality
    Polyclonal
    Application
    Western Blotting (WB)
    • 10
    • 4
    • 3
    • 2
    • 1
    Specificity
    DERL3 antibody was raised against the C terminal of DERL3
    Purification
    Affinity purified
    Immunogen
    DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    Der1-Like Domain Family, Member 3 (DERL3)
    Alternative Name
    DERL3 (DERL3 Antibody Abstract)
    Synonyms
    1810006I20Rik, 1810063P04Rik, IZP6, derlin-3, zgc:63991, C22orf14, LLN2, derlin 3, Der1-like domain family, member 3, DERL3, Derl3, derl3
    Background
    DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
    Molecular Weight
    27 kDa (MW of target protein)
    Pathways
    ER-Nucleus Signaling
You are here:
help Support