Kringle Containing Transmembrane Protein 1 (KREMEN1) antibody

Antigen: Kringle Containing Transmembrane Protein 1 (KREMEN1)

Synonyms: KRM1, KREMEN, FLJ31863, si:ct737139.1, Krm1, Kremen, AV002070, krm1, kremen, KREMEN1, kremem1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN502575

Additional Information

Alternative name: Kremen protein 1

Gene ID: KREMEN1

UniProt: C1P671

Immunogen: The immunogen for anti-KREMEN1 antibody: synthetic peptide directed towards the N terminal of human KREMEN1

Sequence: LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKY CEIPACQMPG

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KREMEN1 antibody concentration is 1 mg/ml.

Description: KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.

Characteristics: Antigen Size: 475 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-KREMEN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KREMEN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Mao, Wu, Davidson et al.: "Kremen proteins are Dickkopf receptors that regulate Wnt/beta-catenin signalling." in: Nature, Vol. 417, Issue 6889, pp. 664-7, 2002 (PubMed).