Chromosome 21 Open Reading Frame 56 (C21orf56) (N-Term) antibody

Details for Product No. ABIN502685
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf56
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(20), (13), (13), (13), (12), (1)
Host
Rabbit
(18), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (4), (3), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502685
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C21orf56
Sequence MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDAR VVGEIAFQLD
Predicted Reactivity Dog : 92 %
Characteristics This is a rabbit polyclonal antibody against C21orf56. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C21orf56
Background The specific function of C21orf56 is not yet known.
Molecular Weight 21 kDa
Gene ID 84221
NCBI Accession NM_032261, NP_115637
UniProt Q9H0A9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 186 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (18), (4)
Reactivities (20), (13), (13), (13), (12), (1)
Applications (13), (10), (4), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top