Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502685

Chromosome 21 Open Reading Frame 56 (C21orf56) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C21orf56
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502685
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the N terminal of human C21orf56
Sequence MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDAR VVGEIAFQLD
Predicted Reactivity Dog : 92%
Characteristics This is a rabbit polyclonal antibody against C21orf56. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C21orf56
Background The specific function of C21orf56 is not yet known.
Molecular Weight 21kDa
Gene ID 84221
NCBI Accession NP_115637, NM_032261
UniProt Q9H0A9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C21orf56 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Chromosome 21 Open Reading Frame 56 (C21orf56)", type "Antibodies"
Hosts (18), (3)
Reactivities (19), (13), (13), (13), (12), (1)
Applications (12), (10), (4), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1), (1)
Beacon