Protein Disulfide Isomerase Family A, Member 4 (PDIA4) (Middle Region) antibody

Details for Product No. ABIN502751
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ERP70, ERP72, ERp-72, AI987846, Cai, Erp72, Erp70, cai, wu:fd20c07, zgc:113965, zgc:136625, zgc:56014, zgc:77773, LOC100229535
Epitope
Middle Region
(4), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(47), (22), (18), (13), (3), (3), (1), (1), (1), (1)
Host
Rabbit
(33), (21)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(45), (13), (11), (10), (10), (7), (4), (4), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN502751
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PDIA4
Sequence TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDP KKDVLIEFYA
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PDIA4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PDIA4
Background The specific function of PDIA4 is not yet known.
Molecular Weight 73 kDa
Gene ID 9601
NCBI Accession NM_004911, NP_004902
UniProt P13667
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 645 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein Disulfide Isomerase Family A, Member 4 (PDIA4) (Middle Region) antibody WB Suggested Anti-PDIA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (33), (21)
Reactivities (47), (22), (18), (13), (3), (3), (1), (1), (1), (1)
Applications (45), (13), (11), (10), (10), (7), (4), (4), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1), (1), (1)
back to top