Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502751

Protein Disulfide Isomerase Family A, Member 4 (PDIA4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ERP70, ERP72, ERp-72, AI987846, Cai, Erp72, Erp70, cai, wu:fd20c07, zgc:113965, zgc:136625, zgc:56014, zgc:77773, LOC100229535
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502751
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PDIA4 antibody: synthetic peptide directed towards the middle region of human PDIA4
Sequence TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDP KKDVLIEFYA
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PDIA4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PDIA4
Background The specific function of PDIA4 is not yet known.
Molecular Weight 73kDa
Gene ID 9601
NCBI Accession NP_004902, NM_004911
UniProt P13667
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PDIA4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Protein Disulfide Isomerase Family A, Member 4 (PDIA4)", type "Antibodies"
Hosts (31), (20)
Reactivities (46), (19), (17), (13), (3), (3), (1), (1), (1), (1)
Applications (42), (10), (10), (9), (8), (6), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon