Did you know that you can buy products from over 140 different suppliers from us?

Tetraspanin 31 (TSPAN31) (Middle Region) antibody

Details for Product No. ABIN502765
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms tspan31, zgc:56710, SAS, sas, 2700085A14Rik, AW742554, Sas
Epitope
Middle Region
(7), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(12)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (7), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502765
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TSPAN31
Sequence CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFT EILGVWLAMR
Predicted Reactivity Dog : 100 %, Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TSPAN31. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TSPAN31
Background TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.
Molecular Weight 23 kDa
Gene ID 6302
NCBI Accession NM_005981, NP_005972
UniProt Q12999
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 210 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ragazzini, Gamberi, Pazzaglia et al.: "Amplification of CDK4, MDM2, SAS and GLI genes in leiomyosarcoma, alveolar and embryonal rhabdomyosarcoma." in: Histology and histopathology, Vol. 19, Issue 2, pp. 401-11, 2004 (PubMed).

Validation Images
back to top