Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502765

Tetraspanin 31 (TSPAN31) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SAS, Sas, AW742554, 2700085A14Rik, tspan31, zgc:56710, sas
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502765
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TSPAN31 antibody: synthetic peptide directed towards the middle region of human TSPAN31
Sequence CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFT EILGVWLAMR
Predicted Reactivity Dog : 100%, Human : 100%
Characteristics This is a rabbit polyclonal antibody against TSPAN31. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TSPAN31
Background TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.
Molecular Weight 23kDa
Gene ID 6302
NCBI Accession NP_005972, NM_005981
UniProt Q12999
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TSPAN31 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ragazzini, Gamberi, Pazzaglia et al.: "Amplification of CDK4, MDM2, SAS and GLI genes in leiomyosarcoma, alveolar and embryonal rhabdomyosarcoma." in: Histology and histopathology, Vol. 19, Issue 2, pp. 401-11, 2004 (PubMed).

Alternatives for antigen "Tetraspanin 31 (TSPAN31)", type "Antibodies"
Hosts (6), (1)
Reactivities (6)
Applications (7), (2), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon