Nicotinamide Nucleotide Transhydrogenase (NNT) antibody

Antigen: Nicotinamide Nucleotide Transhydrogenase (NNT)

Synonyms: MGC126502, MGC126503, MGC83563

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN502788

Additional Information

Alternative name: NNT

Gene ID: NNT

UniProt: Q13423

Immunogen: The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT

Sequence: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKE MSKEFIEAEM

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NNT antibody concentration is 1 mg/ml.

Description: NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. This gene encodes an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encoding the same protein, have been found for this gene.

Characteristics: Antigen Size: 1086 amino acids

Molecular Weight: 114kDa

Application Details

Application Notes: WB Suggested Anti-NNT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-NNT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Liver

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).