NNT antibody (Nicotinamide Nucleotide Transhydrogenase) (N-Term)

Details for Product anti-NNT Antibody No. ABIN635092
Antigen
Epitope
N-Term
4
3
2
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
46
36
33
5
4
4
2
2
2
1
1
1
1
Host
Rabbit
43
3
Clonality
Polyclonal
Conjugate
This NNT antibody is un-conjugated
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Western Blotting (WB)
29
13
9
9
5
3
1
1
1
Options
Immunogen NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
Specificity NNT antibody was raised against the N terminal of NNT
Purification Affinity purified
Antigen
Alternative Name NNT (NNT Antibody Abstract)
Background NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.
Molecular Weight 114 kDa (MW of target protein)
Pathways Proton Transport
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

NNT Blocking Peptide, catalog no. 33R-4206, is also available for use as a blocking control in assays to test for specificity of this NNT antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Nicotinamide Nucleotide Transhydrogenase (NNT) (N-Term) antibody (ABIN635092) NNT antibody used at 1 ug/ml to detect target protein.