Sad1 and UNC84 Domain Containing 2 (SUN2) antibody

Antigen: Sad1 and UNC84 Domain Containing 2 (SUN2)

Synonyms: UNC84B, KIAA0668, MGC133055, MGC133056

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN502807

Additional Information

Alternative name: UNC84B

Gene ID: UNC84B

UniProt: Q9UH99

Immunogen: The immunogen for anti-UNC84B antibody: synthetic peptide directed towards the N terminal of human UNC84B

Sequence: SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAE FSSNWQKEAM

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-UNC84B antibody concentration is 1 mg/ml.

Description: UNC84B may form a physical interaction between the nuclear envelope and the centrosome.

Characteristics: Antigen Size: 717 amino acids

Molecular Weight: 80kDa

Application Details

Application Notes: WB Suggested Anti-UNC84B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-UNC84B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Cerhan, Ansell, Fredericksen et al.: "Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma." in: Blood, Vol. 110, Issue 13, pp. 4455-63, 2007 (PubMed).