DKFZP564J0863 (Middle Region) antibody

Details for Product No. ABIN502810
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(1), (1), (1), (1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN502810
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DKFZP564J0863
Sequence IYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKT KKMGGKDFSF
Predicted Reactivity Human :100 %,   Rat :100 %,   Crab-eating macaque :100 %,   Mouse :100 %,   Bovine :90 %,   Green puffer :80 %,  
Characteristics This is a rabbit polyclonal antibody against DKFZP564J0863. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The exact function of DKFZP564J0863 remains unknown.
Molecular Weight 60 kDa
Gene ID 25923
NCBI Accession NM_015459, NP_056274
UniProt Q6DD88
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 541 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Dias Neto, Correa, Verjovski-Almeida et al.: "Shotgun sequencing of the human transcriptome with ORF expressed sequence tags." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 7, pp. 3491-6, 2000 (PubMed).

Hosts (1)
Reactivities (1), (1), (1), (1)
Applications (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top