Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502827

Family with Sequence Similarity 20, Member A (FAM20A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AIGFS, FP2747, AI606893
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502827
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM20A antibody: synthetic peptide directed towards the N terminal of human FAM20A
Sequence SKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVH LKLVLRFSDF
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Dog : 92%, Chicken : 91%
Characteristics This is a rabbit polyclonal antibody against FAM20A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM20A
Background It belongs to the FAM20 family.The exact function reamins unknwon.
Molecular Weight 61kDa
Gene ID 54757
NCBI Accession NP_060035, NM_017565
UniProt Q96MK3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM20A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Orosz, Tornóczky, Sápi: "Gastrointestinal stromal tumors: a clinicopathologic and immunohistochemical study of 136 cases." in: Pathology oncology research : POR, Vol. 11, Issue 1, pp. 11-21, 2005 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 20, Member A (FAM20A)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (3), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon