Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) antibody

Details for Product No. ABIN502833
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C7orf42, c7orf42, C25H7orf42, TMEM248, 0610007L01Rik, A930023A16Rik, AW557951, G430067H08Rik, MGC79534
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(14), (12), (12), (12), (12), (12), (12)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN502833
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C7orf42
Sequence FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFF KIKEIKSPEM
Predicted Reactivity Human : 100 %, Chicken : 90 %, Horse : 90 %, Pig : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against C7orf42. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C7orf42
Background The exact function of C7orf42 remains unknown.
Molecular Weight 35 kDa
Gene ID 55069
NCBI Accession NM_017994, NP_060464
UniProt Q9NWD8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 314 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) antibody WB Suggested Anti-C7orf42 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology...." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Hosts (14), (1)
Reactivities (14), (12), (12), (12), (12), (12), (12)
Applications (10), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
back to top