Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502833

Chromosome 7 Open Reading Frame 42 (C7orf42) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C7orf42, c7orf42, C25H7orf42, TMEM248, 0610007L01Rik, A930023A16Rik, AW557951, G430067H08Rik, MGC79534
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502833
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C7orf42 antibody: synthetic peptide directed towards the N terminal of human C7orf42
Sequence FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFF KIKEIKSPEM
Predicted Reactivity Human : 100%, Chicken : 92%, Horse : 92%, Pig : 92%, African clawed frog : 83%
Characteristics This is a rabbit polyclonal antibody against C7orf42. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C7orf42
Background The exact function of C7orf42 remains unknown.
Molecular Weight 35kDa
Gene ID 55069
NCBI Accession NP_060464, NM_017994
UniProt Q9NWD8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C7orf42 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Chromosome 7 Open Reading Frame 42 (C7orf42)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12), (12), (12), (12), (12)
Applications (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon