Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502854

UNC Homeobox (UNCX) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UNCX4.1, Chx4, Uncx4.1, PHD1, uncx-4.1, uncx4.1, uncx4.1.2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502854
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UNCX antibody: synthetic peptide directed towards the N terminal of human UNCX
Sequence LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFT GWQLEELEKA
Predicted Reactivity Bovine : 100%, Dog : 100%, Pig : 100%, Rat : 92%, African clawed frog : 91%
Characteristics This is a rabbit polyclonal antibody against UNCX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UNCX
Background UNCX is a transcription factor involved in somitogenesis and neurogenesis. It is required for the maintenance and differentiation of particular elements of the axial skeleton. It may act upstream of PAX9. UNCX plays a role in controlling the development of connections of hypothalamic neurons to pituitary elements, allowing central neurons to reach the peripheral blood circulation and to deliver hormones for control of peripheral functions.
Molecular Weight 54kDa
Gene ID 340260
NCBI Accession NP_001073930, NM_001080461
UniProt A6NJT0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UNCX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Alternatives for antigen "UNC Homeobox (UNCX)", type "Antibodies"
Hosts (24), (2)
Reactivities (22), (15), (12), (12), (12), (12), (1)
Applications (15), (10), (6), (6), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (2), (2)
Beacon