Did you know that you can buy products from over 140 different suppliers from us?

UNC Homeobox (UNCX) (N-Term) antibody

Details for Product No. ABIN502854
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UNCX4.1, Chx4, Uncx4.1, PHD1, uncx-4.1, uncx4.1, uncx4.1.2
Epitope
N-Term
(11), (8), (4), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
(28), (15), (12), (12), (12), (12), (2), (1)
Host
Rabbit
(30), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (10), (10), (6), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN502854
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UNCX
Sequence LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFT GWQLEELEKA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Pig : 100 %, Rat : 90 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against UNCX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UNCX
Background UNCX is a transcription factor involved in somitogenesis and neurogenesis. It is required for the maintenance and differentiation of particular elements of the axial skeleton. It may act upstream of PAX9. UNCX plays a role in controlling the development of connections of hypothalamic neurons to pituitary elements, allowing central neurons to reach the peripheral blood circulation and to deliver hormones for control of peripheral functions.
Molecular Weight 54 kDa
Gene ID 340260
NCBI Accession NM_001080461, NP_001073930
UniProt A6NJT0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 531 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-UNC Homeobox (UNCX) (N-Term) antibody WB Suggested Anti-UNCX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).

Hosts (30), (2)
Reactivities (28), (15), (12), (12), (12), (12), (2), (1)
Applications (21), (10), (10), (6), (3), (2), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (8), (4), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top