Zinc Finger Protein 138 (ZNF138) (C-Term) antibody

Details for Product No. ABIN502868
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms pHZ-32
Epitope
C-Term
(2), (1), (1), (1), (1), (1)
Reactivity
Human
(13), (1), (1), (1), (1)
Host
Rabbit
(10), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN502868
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF138
Sequence IHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYKCEE CGKAFNLS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF138. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF138
Background ZNF138 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 31 kDa
Gene ID 7697
NCBI Accession NM_006524, NP_006515
UniProt P52744
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 262 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Tommerup, Vissing: "Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders." in: Genomics, Vol. 27, Issue 2, pp. 259-64, 1995 (PubMed).

Hosts (10), (2)
Reactivities (13), (1), (1), (1), (1)
Applications (12), (4), (2), (1)
Epitopes (2), (1), (1), (1), (1), (1)
back to top