Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502874

Exportin 5 (XPO5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
exp5, Exp5, RanBp21, AI648907, AW549301, mKIAA1291, 2410004H11Rik, 2700038C24Rik, CG12234, Dmel\\CG12234, Exp-5, RanBP21, dmExp5, exportin-5, ranbp21, DDBDRAFT_0185980, DDBDRAFT_0237583, DDB_0185980,  ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502874
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the middle region of human XPO5
Sequence MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLI AGCIGKPLGE
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Bovine : 92%, Dog : 92%, Mouse : 85%, Rat : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against XPO5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name XPO5
Background Exportin-5 belongs to a large family of karyopherins that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments. Exportin-5 belongs to a large family of karyopherins (see MIM 602738) that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments.
Molecular Weight 136kDa
Gene ID 57510
NCBI Accession NP_065801, NM_020750
UniProt Q9HAV4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-XPO5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Exportin 5 (XPO5)", type "Antibodies"
Hosts (25), (5)
Reactivities (29), (15), (13), (12), (12), (12), (12)
Applications (21), (10), (9), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (3), (2), (2), (2), (1)
Beacon