Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502892

T-Box 15 (TBX15) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TBX14, de, Tbx8, Tbx14, zgc:158205, zgc:63576, TBX15
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502892
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TBX15 antibody: synthetic peptide directed towards the C terminal of human TBX15
Sequence SSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLL CSSPSNGAFG
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against TBX15. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TBX15
Background TBX15 is a probable transcriptional regulator involved in developmental processes.
Molecular Weight 55kDa
Gene ID 6913
NCBI Accession NP_689593, NM_152380
UniProt Q96SF7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TBX15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "T-Box 15 (TBX15)", type "Antibodies"
Hosts (15)
Reactivities (15), (7), (1), (1)
Applications (11), (7), (5), (5), (5), (1), (1)
Epitopes (3), (3), (3), (2), (1), (1), (1)
Beacon