Did you know that you can buy products from over 140 different suppliers from us?

Acetyl-CoA Acyltransferase 2 (ACAA2) (N-Term) antibody

Details for Product No. ABIN502928
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DSAEC, 0610011L04Rik, AI255831, AI265397, D18Ertd240e, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, fb59b11, zgc:56036, wu:fb59b11, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, acetoacetyl-CoA thi ... show more
DSAEC, 0610011L04Rik, AI255831, AI265397, D18Ertd240e, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, fb59b11, zgc:56036, wu:fb59b11, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, acetoacetyl-CoA thiolase 2 show less
Epitope
N-Term
(7), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Chicken
(24), (8), (7), (1), (1), (1), (1)
Host
Rabbit
(17), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(26), (12), (9), (9), (8), (6)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502928
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ACAA2
Sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAAL SAGKVSPETV
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %, African clawed frog : 90 %, Chicken : 90 %, Pig : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against ACAA2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACAA2
Background ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.
Molecular Weight 42 kDa
Gene ID 10449
NCBI Accession NM_006111, NP_006102
UniProt P42765
Research Area Cardiovascular, Fatty Acids, Metabolism, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 397 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Aboulaich, Vainonen, Strålfors et al.: "Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes." in: The Biochemical journal, Vol. 383, Issue Pt 2, pp. 237-48, 2004 (PubMed).

Background publications Rennie, Fraser: "The Islets of Langerhans in Relation to Diabetes." in: The Biochemical journal, Vol. 2, Issue 1-2, pp. 7-19, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502928
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top