Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502928

Acetyl-CoA Acyltransferase 2 (ACAA2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
DSAEC, 0610011L04Rik, AI255831, AI265397, D18Ertd240e, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, fb59b11, zgc:56036, wu:fb59b11, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, acetoacetyl-CoA thi ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN502928
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ACAA2 antibody: synthetic peptide directed towards the N terminal of human ACAA2
Sequence ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAAL SAGKVSPETV
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, African clawed frog : 92%, Chicken : 92%, Pig : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against ACAA2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ACAA2
Background ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.
Molecular Weight 42kDa
Gene ID 10449
NCBI Accession NP_006102, NM_006111
UniProt P42765
Research Area Cardiovascular, Fatty Acids, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ACAA2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Aboulaich, Vainonen, Strålfors et al.: "Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes." in: The Biochemical journal, Vol. 383, Issue Pt 2, pp. 237-48, 2004 (PubMed).

Background publications Rennie, Fraser: "The Islets of Langerhans in Relation to Diabetes." in: The Biochemical journal, Vol. 2, Issue 1-2, pp. 7-19, 2006 (PubMed).

Alternatives for antigen "Acetyl-CoA Acyltransferase 2 (ACAA2)", type "Antibodies"
Hosts (11), (8)
Reactivities (18), (7), (7), (1), (1), (1), (1)
Applications (19), (9), (9), (9), (2)
Epitopes (2), (2), (1), (1)
Beacon