Acetyl-CoA Acyltransferase 2 (ACAA2) antibody

Antigen: Acetyl-CoA Acyltransferase 2 (ACAA2)

Synonyms: ACAT2, ARGP2, ACACT2, MGC116732, DSAEC, FLJ35992, FLJ95265, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, Tcp-1x, AW742799, Tcp1-rs1, MGC36039, D15Wsu97e, Acat-2, Ab2-076, MGC95138, acat2, MGC76038, fb59b11, zgc:56036, wu:fb59b11, MGC140551, ACAA2, MGC127380, MGC89951, ACETOACETYL-COA THIOLASE 2, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, DKFZp469F1024, DKFZp470L0527

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN502928

Additional Information

Alternative name: ACAA2

Gene ID: ACAA2

UniProt: P42765

Immunogen: The immunogen for anti-ACAA2 antibody: synthetic peptide directed towards the N terminal of human ACAA2

Sequence: ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAAL SAGKVSPETV

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ACAA2 antibody concentration is 1 mg/ml.

Description: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Characteristics: Antigen Size: 397 amino acids

Molecular Weight: 42kDa

Synonyms: ACAT2, ARGP2, ACACT2, MGC116732, DSAEC, FLJ35992, FLJ95265, fb10a06, fb53f08, wu:fb10a06, wu:fb53f08, Tcp-1x, AW742799, Tcp1-rs1, MGC36039, D15Wsu97e, Acat-2, Ab2-076, MGC95138, acat2, MGC76038, fb59b11, zgc:56036, wu:fb59b11, MGC140551, ACAA2, MGC127380, MGC89951, ACETOACETYL-COA THIOLASE 2, EMB1276, EMBRYO DEFECTIVE 1276, MIF21.12, MIF21_12, DKFZp469F1024, DKFZp470L0527

Application Details

Application Notes: WB Suggested Anti-ACAA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cardiovascular, Fatty Acids, Metabolism, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-ACAA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Aboulaich, Vainonen, Strålfors et al.: "Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes." in: The Biochemical journal, Vol. 383, Issue Pt 2, pp. 237-48, 2004 (PubMed).