Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503025

NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310010O12Rik, 2810405F18Rik, AI507900, Shtap, RGD1559652, RP4-603I14.2, SHTAP
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503025
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NSUN4 antibody: synthetic peptide directed towards the N terminal of human NSUN4
Sequence QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQS EGGQSAAPSP
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 85%, Guinea pig : 84%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against NSUN4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NSUN4
Background NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity
Molecular Weight 43kDa
Gene ID 387338
NCBI Accession NP_950245, NM_199044
UniProt Q96CB9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NSUN4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4)", type "Antibodies"
Hosts (3), (1)
Reactivities (3)
Applications (3), (1)
Epitopes (1), (1)
Beacon