Did you know that you can buy products from over 140 different suppliers from us?

NOL1/NOP2/Sun Domain Family, Member 4 (NSUN4) (N-Term) antibody

Details for Product No. ABIN503025
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310010O12Rik, 2810405F18Rik, AI507900, Shtap, RP4-603I14.2, SHTAP, RGD1559652
Epitope
N-Term
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(4)
Host
Rabbit
(3), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503025
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NSUN4
Sequence QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQS EGGQSAAPSP
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Rabbit : 80 %, Guinea pig : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against NSUN4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NSUN4
Background NSUN4 may have S-adenosyl-L-methionine-dependent methyl-transferase activity
Molecular Weight 43 kDa
Gene ID 387338
NCBI Accession NM_199044, NP_950245
UniProt Q96CB9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 384 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top