Did you know that you can buy products from over 140 different suppliers from us?

Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2) (N-Term) antibody

Details for Product No. ABIN503027
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MEKK2, MEKK2B, Mekk2, 9630061B06Rik, AI585793, Mekk2b
Epitope
N-Term
(7), (7), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Human
(35), (18), (17), (12), (12), (12)
Host
Rabbit
(31), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(28), (15), (11), (10), (10), (7), (4), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503027
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MAP3K2
Sequence AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTS INSEGEFIPE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 90 %, Rabbit : 90 %, Mouse : 80 %, Rat : 80 %, Horse : 80 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against MAP3K2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAP3K2
Background MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.
Molecular Weight 70 kDa
Gene ID 10746
NCBI Accession NM_006609, NP_006600
UniProt Q9Y2U5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 619 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2) (N-Term) antibody WB Suggested Anti-MAP3K2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Hosts (31), (6)
Reactivities (35), (18), (17), (12), (12), (12)
Applications (28), (15), (11), (10), (10), (7), (4), (3), (3)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (7), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503027
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top