Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503027

Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MEKK2, MEKK2B, Mekk2, 9630061B06Rik, AI585793, Mekk2b
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503027
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2
Sequence AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTS INSEGEFIPE
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 92%, Rabbit : 92%, Mouse : 85%, Rat : 85%, Horse : 80%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against MAP3K2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAP3K2
Background MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.
Molecular Weight 70kDa
Gene ID 10746
NCBI Accession NP_006600, NM_006609
UniProt Q9Y2U5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAP3K2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Alternatives for antigen "Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2)", type "Antibodies"
Hosts (28), (5)
Reactivities (32), (18), (15), (13), (12), (12), (1), (1)
Applications (24), (10), (10), (6), (6), (5), (5), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (2), (1), (1)
Beacon