Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2) antibody

Antigen: Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2)

Synonyms: MEKK2, MEKK2B, Mekk2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503027

Additional Information

Alternative name: MAP3K2

Gene ID: MAP3K2

UniProt: Q9Y2U5

Immunogen: The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2

Sequence: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTS INSEGEFIPE

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MAP3K2 antibody concentration is 1 mg/ml.

Description: MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-18 AF111105.1 37-54 19-79 AI760702.1 474-534 80-371 AF111105.1 116-407 372-2650 AB208963.1 313-2591 2651-3557 AK075004.1 2050-2956 3558-3571 BQ423724.1 71-84 3572-3577 W07290.1 11-16 3578-4302 AK074577.1 1-725 4303-4421 BM470563.1 21-139 4422-4424 AK074577.1 845-847 4425-4941 BM470563.1 142-658

Characteristics: Antigen Size: 619 amino acids

Molecular Weight: 70kDa

Application Details

Application Notes: WB Suggested Anti-MAP3K2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MAP3K2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Publications

Product: Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).