T-Cell Leukemia Translocation Altered (TCTA) (Middle Region) antibody

Details for Product No. ABIN503061
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN503061
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TCTA
Sequence IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEM AANEPLKTHR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against TCTA. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCTA
Background A chromosomal aberration, translocation t(1,3)(p34,p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).
Molecular Weight 11 kDa
Gene ID 6988
NCBI Accession NM_022171, NP_071503
UniProt P57738
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 103 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
back to top