MGC4172 (Middle Region) antibody

Details for Product No. ABIN503092
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(1), (1), (1), (1), (1), (1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN503092
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MGC4172
Sequence DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQ ELREAQTHIR
Predicted Reactivity Dog (Canine), Zebrafish (Danio rerio), Pig (Porcine), Horse (Equine), Rabbit, Rat (Rattus), Human, Mouse (Murine), Cow (Bovine), Guinea Pig
Characteristics This is a rabbit polyclonal antibody against MGC4172. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The function of this protein remains unknown.
Molecular Weight 28 kDa
Gene ID 79154
NCBI Accession NM_024308, NP_077284
UniProt Q6UWP2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 260 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (1)
Reactivities (1), (1), (1), (1), (1), (1)
Applications (1)
Epitopes (1)
back to top