Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503093

Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FIGLER1, SALM4, A530045B06Rik, Salm4
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503093
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LRFN3 antibody: synthetic peptide directed towards the C terminal of human LRFN3
Sequence VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTA TRPVGCARFS
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Dog : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against LRFN3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LRFN3
Background LRFN3 belongs to the LRFN family. Its exact function remains unknown.
Molecular Weight 66kDa
Gene ID 79414
NCBI Accession NP_078785, NM_024509
UniProt Q9BTN0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LRFN3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3)", type "Antibodies"
Hosts (28)
Reactivities (27), (25), (25), (17), (17)
Applications (15), (14), (13), (10), (7), (7)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
Beacon