Did you know that you can buy products from over 140 different suppliers from us?

Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody

Details for Product No. ABIN503093
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FIGLER1, SALM4, A530045B06Rik, Salm4, LRFN3
Epitope
C-Term
(4), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(28), (26), (26), (17), (17)
Host
Rabbit
(29)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (15), (14), (10), (7), (7)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503093
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human LRFN3
Sequence VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTA TRPVGCARFS
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Dog : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against LRFN3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LRFN3
Background LRFN3 belongs to the LRFN family. Its exact function remains unknown.
Molecular Weight 66 kDa
Gene ID 79414
NCBI Accession NM_024509, NP_078785
UniProt Q9BTN0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 628 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) antibody WB Suggested Anti-LRFN3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Validation Images
back to top