Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503103

Leucine Rich Repeat Transmembrane Neuronal 4 (LRRTM4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A230052N11, 7530419J18Rik, RGD1560707, DKFZp459D155
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503103
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LRRTM4 antibody: synthetic peptide directed towards the middle region of human LRRTM4
Sequence FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSE VQVVNTERSH
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against LRRTM4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LRRTM4
Background The specific function of this protein remains unknown.
Molecular Weight 59kDa
Gene ID 80059
NCBI Accession NP_079269, NM_024993
UniProt Q6ZT31
Research Area Organogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LRRTM4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Leucine Rich Repeat Transmembrane Neuronal 4 (LRRTM4)", type "Antibodies"
Hosts (27), (2)
Reactivities (26), (17), (17), (17), (17), (17), (17)
Applications (15), (15), (10), (9), (6), (5), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (1)
Beacon