Leucine Rich Repeat Transmembrane Neuronal 4 (LRRTM4) (Middle Region) antibody

Details for Product No. ABIN503103
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A230052N11, 7530419J18Rik, RGD1560707, DKFZp459D155
Epitope
Middle Region
(4), (3), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(27), (17), (17), (17), (17), (17), (17), (2)
Host
Rabbit
(28), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (15), (10), (10), (7), (5), (2)
Pubmed 1 reference available
Catalog no. ABIN503103
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LRRTM4
Sequence FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSE VQVVNTERSH
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against LRRTM4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LRRTM4
Background The specific function of this protein remains unknown.
Molecular Weight 59 kDa
Gene ID 80059
NCBI Accession NM_024993, NP_079269
UniProt Q6ZT31
Research Area Organogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 518 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Leucine Rich Repeat Transmembrane Neuronal 4 (LRRTM4) (Middle Region) antibody WB Suggested Anti-LRRTM4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Hosts (28), (2)
Reactivities (27), (17), (17), (17), (17), (17), (17), (2)
Applications (16), (15), (10), (10), (7), (5), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top